General Information

  • ID:  hor000934
  • Uniprot ID:  Q7M3V5
  • Protein name:  Callisulfakinin-1
  • Gene name:  NA
  • Organism:  Calliphora vomitoria (Blue bottle fly) (Musca vomitoria)
  • Family:  Gastrin/cholecystokinin family
  • Source:  Animal
  • Expression:  In brain, it is specifically expressed in four pairs of neurons. Not expressed in other cells of the brain and in the thoracico-abdominal ganglion.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Calliphora (genus), Calliphorinae (subfamily), Calliphoridae (family), Oestroidea (superfamily), Calyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  FDDYGHMRF
  • Length:  9(111-119)
  • Propeptide:  MYSQQRIFNSKYFIFFIAVLSIFWLPTMSARNLENSKNENGISGSNSGNGKMNSQYNTGSPSAYYSAKHNLRSMLMAPKDYQQKLHAKIPLNLDLMDFLLEYEDEDRSKRFDDYGHMRFGKRGGEEQFDDYGHMRFGRSI
  • Signal peptide:  MYSQQRIFNSKYFIFFIAVLSIFWLPTMSA
  • Modification:  T4 Sulfotyrosine;T9 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Callisulfakinin I is a neuropeptide. The existence of Callisulfakinin II is uncertain.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q7M3V5-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000934_AF2.pdbhor000934_ESM.pdb

Physical Information

Mass: 133017 Formula: C54H70N14O15S
Absent amino acids: ACEIKLNPQSTVW Common amino acids: DF
pI: 5.41 Basic residues: 2
Polar residues: 2 Hydrophobic residues: 2
Hydrophobicity: -98.89 Boman Index: -2791
Half-Life / Aliphatic Index: 1.1 hour Aliphatic Index: 0
Instability Index: 478.89 Extinction Coefficient cystines: 1490
Absorbance 280nm: 186.25

Literature

  • PubMed ID:  7556217
  • Title:  The sulfakinins of the blowfly Calliphora vomitoria. Peptide isolation, gene cloning and expression studies.